| Transcript | Ll_transcript_356410 |
|---|---|
| CDS coordinates | 1-501 (+) |
| Peptide sequence | IPPVTVPPVVKPPVTLPVPIPPVTVPPVLKPPVTLPVPIPPVTVPPVTVPPVTVPPVLNPPTTPGTGGKSPCPSPSPPAQETCPIDILKLGGCVDLLGGLVHIGLGDPAVNECCPLLQGLAEVEAAVCLCTTIKLKLLNLNIFVPIALQLLVACGKSPPPGYTCSL* |
| ORF Type | 5prime_partial |
| Blastp | 36.4 kDa proline-rich protein from Lycopersicon with 65.52% of identity |
|---|---|
| Blastx | 36.4 kDa proline-rich protein from Lycopersicon with 65.52% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464051.1) |
| Pfam | Hydrophobic seed protein (PF14547.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer