Protein coding transcript 172563

• Transcript: Ll_transcript_25337
• CDS coordinates: 923-1330 (+)
• Peptide sequence: MVQSGIWRINIVLGSINAKLSMFRECTAVTTLTLEIIRALAREGIPSVGISPFSCGWFTRERQVSSADLSSVAKAIDSGFTPVLHGDAVLDEILGCTILSGDVIISHLAAYSKPEYVVFLTDVYGVYDRPPTEPDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_25337

• Blastp: Isopentenyl phosphate kinase from Methanothermobacter with 38.94% of identity
• Blastx: Isopentenyl phosphate kinase from Methanothermobacter with 38.94% of identity
• Eggnog: Aspartate glutamate uridylate kinase(COG1608)
• Kegg: Link to kegg annotations (MTH_47)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459052.1)
• Pfam: Amino acid kinase family (PF00696.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;