Protein coding transcript 172662

• Transcript: Ll_transcript_23325
• CDS coordinates: 250-1383 (+)
• Peptide sequence: MVISRIFHRRIWTTARRFLRPTALVPFEKCSLPSSPLFQKHIPNNFKHGNRFWFSTQSMVDLLPMGKIVDVPLAQTGEGIAECELLKWHVQEGDYIEDFQPICEVQSDKANIEITSRYRGKVASILYVPGDIVKVGETLLKILVDESAAFPSVTSGDSENEKSLDSDQIVVDEAAFTAVTFCDSENVNSLDSDLEKENRAGVLSTPAVRSLAKQHGIDINEVCGSGKDGRVLKEDVLSFAVNKGIIRNPSAVLNSDHGEKPPGEEGYNSFVATKYESPSEDRILPLRGYQRAMVKSMSLAAKVPHFHYVDEIKCDALLELKTSFQKNNPYKDVKYTFLPILIKSLSMALTKYPFVNSCFIEDSLEVVLKVNIRFFLH*
• ORF Type: complete

Annotations of Ll_transcript_23325

• Blastp: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial from Arabidopsis with 49.09% of identity
• Blastx: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial from Arabidopsis with 49.61% of identity
• Eggnog: Dehydrogenase(COG0508)
• Kegg: Link to kegg annotations (AT3G06850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451077.1)
• Pfam: Biotin-requiring enzyme (PF00364.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;