Protein coding transcript 172681

• Transcript: Ll_transcript_23405
• CDS coordinates: 1704-2498 (+)
• Peptide sequence: MATPIGKGHRSLNLTLRKELSLYANVRPCYSLPGYKTRYDNVNLITIRENTEGEYSGLEHQVVRGVVESLKIITRHASLRVAEYAFHYAKVHGRERVSAIHKANIMQKTDGLFLKCCREVAEKYPEIKYEEVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLIGGLGLTPSCNIGEGGIALAEAVHGSAPDIAGKNLANPTALLLSGVTMLRHLDLHDKADRIQNAILNTIAEGKYRTADLGGSSKTTEFTAAIIDHL*
• ORF Type: complete

Annotations of Ll_transcript_23405

• Blastp: Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial from Arabidopsis with 90.91% of identity
• Blastx: Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial from Arabidopsis with 90.97% of identity
• Eggnog: 3-isopropylmalate dehydrogenase activity(COG0473)
• Kegg: Link to kegg annotations (AT5G03290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435274.1)
• Pfam: Isocitrate/isopropylmalate dehydrogenase (PF00180.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;