Protein coding transcript 172697

• Transcript: Ll_transcript_24190
• CDS coordinates: 327-770 (+)
• Peptide sequence: MDDDILNMSNWGYYEPFKGGHLGLQLMPGMTDRGTKPFLPGRDPSMLVGGNDHDSKPYLSGRDPSFFIGVNDRDSKPYSSGRDSSMFIGANDRDSKPFLSGRDPSMFVGVNDRDRDIKPFLPGRDPSMFVGVNDRDRDIKPFLPGRDP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_24190

• Blastp: Protein BASIC PENTACYSTEINE2 from Arabidopsis with 54.84% of identity
• Blastx: Protein BASIC PENTACYSTEINE2 from Arabidopsis with 54.84% of identity
• Eggnog: GAGA-binding transcriptional activator(ENOG410YBIV)
• Kegg: Link to kegg annotations (AT1G14685)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446379.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;