Protein coding transcript 172698

• Transcript: Ll_transcript_24164
• CDS coordinates: 1-300 (+)
• Peptide sequence: PVCSCTGTPQQCYRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLAAEGYNFANPINLRTHWARHGTNKFVTISCIGLITML*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_24164

• Blastp: Protein BASIC PENTACYSTEINE1 from Arabidopsis with 85.56% of identity
• Blastx: Protein BASIC PENTACYSTEINE1 from Arabidopsis with 85.56% of identity
• Eggnog: GAGA-binding transcriptional activator(ENOG410YBIV)
• Kegg: Link to kegg annotations (AT2G01930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448205.1)
• Pfam: GAGA binding protein-like family (PF06217.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;