Transcript | Ll_transcript_24183 |
---|---|
CDS coordinates | 283-1152 (+) |
Peptide sequence | MDGDNGLNMRNWGYYEATTPFKNHLGLQLMSSMPEKQPLLGARNAAAAAPFHRRDTGMLQPAYPVEYMRDAWIGHNHRDKFMNMNINMIPTNNNYSVVPETSSSHQMQMVEAQPEPADQSEEETPVEEEPPIEMVNGTGKKRGKGAKAPKAPKAKKPRKGPREPKDENATSVQRGRTIKRSAEIVINGIDMDLSSIPIPVCSCTGAPQQCYRWGSGGWQSACCTTGISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEGYNFSNPIDLKTYWAKHGTNKFVTIR* |
ORF Type | complete |
Blastp | Protein BASIC PENTACYSTEINE1 from Arabidopsis with 50% of identity |
---|---|
Blastx | Protein BASIC PENTACYSTEINE2 from Arabidopsis with 47.64% of identity |
Eggnog | GAGA-binding transcriptional activator(ENOG410YBIV) |
Kegg | Link to kegg annotations (AT2G01930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457201.1) |
Pfam | GAGA binding protein-like family (PF06217.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer