Protein coding transcript 172718

• Transcript: Ll_transcript_24782
• CDS coordinates: 246-1139 (+)
• Peptide sequence: MKNQNVVDPVAKSRVNTLVAFANSTNLLKSSVTASSLGGFWGLYAKKLMKTLKNSKGDAKVNTFIDSMRASSPTRSKSEENQDKTPTWILYHPSALNMFDEIVYNSRGKQIVTFLDYDGTLSPIVADPEKAYMTSKMKGTLKEIARHFPTAIVTGRCRDKVYNFVRLAEVYYAGSHGMDIKGPQKNRSPKKGNNGKSVLFQPASQFLPMINEVYKILQEITKSVPGAMVENNKFCLSVHFRCVDEKSWAPLAEKVKLVLNEYPKLKLTQGRKVLEIRPTIKWDKGKAIEFLLHSLGE*
• ORF Type: complete

Annotations of Ll_transcript_24782

• Blastp: Probable trehalose-phosphate phosphatase J from Arabidopsis with 58.8% of identity
• Blastx: Probable trehalose-phosphate phosphatase J from Arabidopsis with 58.8% of identity
• Eggnog: trehalose biosynthetic process(COG1877)
• Kegg: Link to kegg annotations (AT5G65140)
• CantataDB: Link to cantataDB annotations (CNT0001633)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461842.1)
• Pfam: Trehalose-phosphatase (PF02358.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;