Protein coding transcript 17277

• Transcript: Ll_transcript_355861
• CDS coordinates: 2-325 (+)
• Peptide sequence: LCKEGRIDEAISLLDEMQIEGIFPNHVAFNVLINALCKKGDLGRASKLVDNMFLKGCVPNEVTYNALVHGLCKEGRIDEAISLLDEMQIEGIFPNHVAFNVLINALCK
• ORF Type: internal

Annotations of Ll_transcript_355861

• Blastp: Pentatricopeptide repeat-containing protein At4g20090 from Arabidopsis with 64.81% of identity
• Blastx: Pentatricopeptide repeat-containing protein At4g20090 from Arabidopsis with 64.81% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT4G20090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439321.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;