Protein coding transcript 172844

• Transcript: Ll_transcript_23466
• CDS coordinates: 1183-1794 (+)
• Peptide sequence: MAFIRGTYPPGHCSPPFGNCSTGNSDVEPFVVMHNMLLSHAKAVELYRKHFQAKQGGTIGIVAHTFMYEPLRDEECDRQAKNRAMAFHLGWVLDPLVFGEYPAEMRSILGSQLPRFSPEEKSMLKGSLDFIGINHYGSLYAKDCSHSACALGADHPIRGFVETTGMRDGIPIGDPTGMSRFFVVPRGMEKTVDYIKIRYHNMVM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_23466

• Blastp: Beta-glucosidase 18 from Oryza sativa with 51.96% of identity
• Blastx: Beta-glucosidase 18 from Oryza sativa with 52.1% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (4336391)
• CantataDB: Link to cantataDB annotations (CNT0000706)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425298.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;