Protein coding transcript 172865

• Transcript: Ll_transcript_23487
• CDS coordinates: 1071-1379 (+)
• Peptide sequence: MAFIRGTYPPGHCSPPFGNCSTGNSDVEPFVVMHNMLLSHAKAVELYRKHFQVTKKPKLKAPVATFSKKGQDEHLFNKLMNNVLNPGKARWNYWHCCTYLHV*
• ORF Type: complete

Annotations of Ll_transcript_23487

• Blastp: Beta-glucosidase 45 from Arabidopsis with 46.15% of identity
• Blastx: Probable inactive beta-glucosidase 14 from Oryza sativa with 57.81% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (AT1G61810)
• CantataDB: Link to cantataDB annotations (CNT0000706)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014492159.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;