Protein coding transcript 172868

• Transcript: Ll_transcript_23461
• CDS coordinates: 315-752 (+)
• Peptide sequence: MHNMLLSHAKAVELYRKNFQAKQGGTIGIVVITVMFEPLRDEECDREAVNRALAFLIAWVLDPLVFGEYPAEMRSILGSQLPSFSPKEKSILKGSLDFIGINHYGTLYAKDCSHSACSLFAKRPIRGFLEATGMRDGIPIGDPVA*
• ORF Type: complete

Annotations of Ll_transcript_23461

• Blastp: Beta-glucosidase 18 from Oryza sativa with 52.08% of identity
• Blastx: Beta-glucosidase 18 from Oryza sativa with 50.26% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (4336391)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425300.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;