Transcript | Ll_transcript_23462 |
---|---|
CDS coordinates | 702-1139 (+) |
Peptide sequence | MHNMLLSHAKAVELYRKNFQAKQGGTIGIVVITVMFEPLRDEECDREAVNRALAFLIAWVLDPLVFGEYPAEMRSILGSQLPSFSPKEKSILKGSLDFIGINHYGTLYAKDCSHSACSLFAKRPIRGFLEATGMRDGIPIGDPVA* |
ORF Type | complete |
Blastp | Beta-glucosidase 18 from Oryza sativa with 52.08% of identity |
---|---|
Blastx | Beta-glucosidase 18 from Oryza sativa with 50.26% of identity |
Eggnog | beta-glucosidase(COG2723) |
Kegg | Link to kegg annotations (4336391) |
CantataDB | Link to cantataDB annotations (CNT0000706) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425300.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer