Protein coding transcript 172922

• Transcript: Ll_transcript_24798
• CDS coordinates: 562-1326 (+)
• Peptide sequence: MKSKWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWILVRALWHFHYKKNLIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVLVPAKSHIRIIVTSADVLHSWAVPSLGVKCDAVPGRLNQISILVQREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIP*
• ORF Type: complete

Annotations of Ll_transcript_24798

• Blastp: Cytochrome c oxidase subunit 2 from Arabidopsis with 96.02% of identity
• Blastx: Cytochrome c oxidase subunit 2 from Arabidopsis with 95.33% of identity
• Eggnog: Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B) (By similarity)(COG1622)
• Kegg: Link to kegg annotations (ArthMp015)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235101.1)
• Pfam: Cytochrome C oxidase subunit II, transmembrane domain (PF02790.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;