Protein coding transcript 17299

• Transcript: Ll_transcript_356000
• CDS coordinates: 3-491 (+)
• Peptide sequence: FENVFFSGDSAGANLAHQMGIRVGLEGLPGVKLEGIVLANPYFWGVDRIGSESGKEFAPKVDMLWRFACPKTSGSDDPLINPDKDPNLVKLGCKRMLVFVAEKDILKDRGLYYKELLQKRGWNGVVEVVETKGEDHVFHIFKPTSKEALVLLDHVVTFMKHN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_356000

• Blastp: Probable carboxylesterase 2 from Arabidopsis with 45.12% of identity
• Blastx: Probable carboxylesterase 2 from Arabidopsis with 45.12% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT1G47480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449477.1)
• Pfam: alpha/beta hydrolase fold (PF07859.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;