Protein coding transcript 1730

• Transcript: Ll_transcript_318077
• CDS coordinates: 115-531 (+)
• Peptide sequence: MGFPVCYSDFMFSKLIFHILSLFSIIRKLICTFFRFIGLQDFIEPHTSGSHNPTHMIHKILPVVSYKDLVDPPDSCAVCLNEFEEVDEIRRLANCTHVFHRGCLDRWIGYDQRTCPLCRTAFIPHEINQSLWSASVAL*
• ORF Type: complete

Annotations of Ll_transcript_318077

• Blastp: E3 ubiquitin-protein ligase RHA1B from Arabidopsis with 33.56% of identity
• Blastx: E3 ubiquitin-protein ligase RHA1B from Arabidopsis with 33.56% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G11360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429888.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;