Protein coding transcript 173009

• Transcript: Ll_transcript_24291
• CDS coordinates: 293-613 (+)
• Peptide sequence: MASFRAFLNSPVGPKTTHFWGPVANWGFVAAGLADMQKPPEMISGNMTGAMCIYSALFMRFAWMVKPRNYLLLACHVSNEGVQLYQLSRWAKAQGYLAEKKEEASS*
• ORF Type: complete

Annotations of Ll_transcript_24291

• Blastp: Mitochondrial pyruvate carrier 1 from Arabidopsis with 85.29% of identity
• Blastx: Mitochondrial pyruvate carrier 1 from Arabidopsis with 85.29% of identity
• Eggnog: Brain protein 44-like(ENOG4111TU9)
• Kegg: Link to kegg annotations (AT5G20090)
• CantataDB: -
• Mirbase: ath-MIR5655 (MI0019238)
• Ncbi protein: Link to NCBI protein (XP_019451598.1)
• Pfam: Uncharacterised protein family (UPF0041) (PF03650.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;