Protein coding transcript 173010

• Transcript: Ll_transcript_24293
• CDS coordinates: 217-711 (+)
• Peptide sequence: MGQGTGSLTKKVIGTASLNQGLFVIDLPHKAHSSSSISVSVSHSFASHGAKFSLWHLRLGHAPLSLMKILSSHFPFIPLCNKDLVPCDVCHTSRQKRLPFCNSETHSNTIFQLLHADIWGPYSTTSVFGHNYFLTLVDDFTRFTWVILMKHKSETRQHIVNLLI*
• ORF Type: complete

Annotations of Ll_transcript_24293

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 32.69% of identity
• Blastx: Mitochondrial pyruvate carrier 1 from Arabidopsis with 82.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451598.1)
• Pfam: GAG-pre-integrase domain (PF13976.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;