Transcript | Ll_transcript_24942 |
---|---|
CDS coordinates | 753-1151 (+) |
Peptide sequence | MEVTGFSAEVREQVYKLASVNLCSNISGQILSSLVMSPPKVGDESYELYKAERDAILSSLTRRAKTLEDALNKLEGVSCNKAEGAMYLFPRIRLPEKAIKAAEAVNKAPDAFYCARLLNATGVVVVPGSGFGQ |
ORF Type | 3prime_partial |
Blastp | Alanine aminotransferase 2, mitochondrial from Arabidopsis with 81.2% of identity |
---|---|
Blastx | Alanine aminotransferase 2, mitochondrial from Arabidopsis with 85.55% of identity |
Eggnog | aminotransferase(COG0436) |
Kegg | Link to kegg annotations (AT1G72330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455538.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer