Transcript | Ll_transcript_24956 |
---|---|
CDS coordinates | 1596-2243 (+) |
Peptide sequence | MMMQLLIRSENDGILCPIPQYPLYSASIALHGGTLVPYYLDEATGWGLEISELKKQLEDAKSKGINVRALVVINPGNPTGQVLSEENQREIVKFCKLEGLVLLADEVYQENVYVPEKEFHSFKKISRSVGYGENDIALVSFQSVSKGYYGECGKRGGYMEVTGFSSEVREQIYKVASVNLCSNISGQILASLVMSPPKVNSLPLKVKFLFGGAIL* |
ORF Type | complete |
Blastp | Alanine aminotransferase 1, mitochondrial from Arabidopsis with 89.9% of identity |
---|---|
Blastx | Alanine aminotransferase 1, mitochondrial from Arabidopsis with 88.82% of identity |
Eggnog | aminotransferase(COG0436) |
Kegg | Link to kegg annotations (AT1G17290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461042.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer