Protein coding transcript 173042

• Transcript: Ll_transcript_24944
• CDS coordinates: 363-761 (+)
• Peptide sequence: MEVTGFSAEVREQVYKLASVNLCSNISGQILSSLVMSPPKVGDESYELYKAERDAILSSLTRRAKTLEDALNKLEGVSCNKAEGAMYLFPRIRLPEKAIKAAEAVNKAPDAFYCARLLNATGVVVVPGSGFGQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_24944

• Blastp: Alanine aminotransferase 2, mitochondrial from Arabidopsis with 81.2% of identity
• Blastx: Alanine aminotransferase 2, mitochondrial from Arabidopsis with 84.83% of identity
• Eggnog: aminotransferase(COG0436)
• Kegg: Link to kegg annotations (AT1G72330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455538.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;