Protein coding transcript 173043

• Transcript: Ll_transcript_24945
• CDS coordinates: 1596-2585 (+)
• Peptide sequence: MMMQLLIRSENDGILCPIPQYPLYSASIALHGGTLVPYYLDEATGWGLEISELKKQLEDAKSKGINVRALVVINPGNPTGQVLSEENQREIVKFCKLEGLVLLADEVYQENVYVPEKEFHSFKKISRSVGYGENDIALVSFQSVSKGYYGECGKRGGYMEVTGFSSEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYELYKAERDAILSSLTRRAKTLEDALNKLEGVSCNKAEGAMYLFPRIRLPEKAIKAAEAVNKAPDAFYCARLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTAFHEKFIDEFRD*
• ORF Type: complete

Annotations of Ll_transcript_24945

• Blastp: Alanine aminotransferase 2, mitochondrial from Arabidopsis with 85.41% of identity
• Blastx: Alanine aminotransferase 2, mitochondrial from Arabidopsis with 85.98% of identity
• Eggnog: aminotransferase(COG0436)
• Kegg: Link to kegg annotations (AT1G72330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461042.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;