Transcript | Ll_transcript_318133 |
---|---|
CDS coordinates | 3-335 (+) |
Peptide sequence | VCHISTFFGADPELDDFMETYLNLLVKYKSDISKPFEEATTFLKDMETQLNSICNSVPNISDEVFGASKKELSVEDKEAIESKRINEDQELKDNLLRRYSGHISNLKHELS |
ORF Type | internal |
Blastp | Homeobox protein knotted-1-like 6 from Arabidopsis with 50.45% of identity |
---|---|
Blastx | Homeobox protein knotted-1-like 6 from Arabidopsis with 50.45% of identity |
Eggnog | homeobox(ENOG410XPMQ) |
Kegg | Link to kegg annotations (AT1G23380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416427.1) |
Pfam | KNOX2 domain (PF03791.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer