Protein coding transcript 1731

• Transcript: Ll_transcript_318133
• CDS coordinates: 3-335 (+)
• Peptide sequence: VCHISTFFGADPELDDFMETYLNLLVKYKSDISKPFEEATTFLKDMETQLNSICNSVPNISDEVFGASKKELSVEDKEAIESKRINEDQELKDNLLRRYSGHISNLKHELS
• ORF Type: internal

Annotations of Ll_transcript_318133

• Blastp: Homeobox protein knotted-1-like 6 from Arabidopsis with 50.45% of identity
• Blastx: Homeobox protein knotted-1-like 6 from Arabidopsis with 50.45% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT1G23380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416427.1)
• Pfam: KNOX2 domain (PF03791.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;