Protein coding transcript 173144

• Transcript: Ll_transcript_24877
• CDS coordinates: 165-578 (+)
• Peptide sequence: MVYQVKIGDLGLAAIVGKNHIAHSILGTPEFMAPELYDEDYTELVDIYSFGLCVLEMVTLEIPYSECDSVAKIYKKVTSGVRPEALNKVQDAEVKGFIEKCLAQPRARPSAAELLEDSFFDELVEDDDENDDCSCSY*
• ORF Type: complete

Annotations of Ll_transcript_24877

• Blastp: Probable serine/threonine-protein kinase WNK11 from Arabidopsis with 80.99% of identity
• Blastx: Probable serine/threonine-protein kinase WNK11 from Arabidopsis with 83.49% of identity
• Eggnog: WNK lysine deficient protein kinase(ENOG410XQWZ)
• Kegg: Link to kegg annotations (AT5G55560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435659.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;