Transcript | Ll_transcript_24896 |
---|---|
CDS coordinates | 114-1022 (+) |
Peptide sequence | MMPSVTIDPSDNDSEPFVEVDPTGRYGKYSELLGCGAVKKVYRAFDQEEGIEVAWNQVNLRNFCDDPAMMDRLYSEVRLLRSMTNKHIIALYNVWKDGQKNTLNFITEVCTSGNLREYRKKHKHVSLKALKKWSKQILNGLNYLHMHDPCIIHRDLNCSNVFVNGNTGQVKIGDLGLAAIVGKNHIAHSILGTPEFMAPELYDEDYTELVDIYSFGLCVLEMVTLEIPYSECDSVAKIYKKVTSGVRPEALNKVQDAEVKGFIEKCLAQPRARPSAAELLEDSFFDELVEDDDENDDCSCSY* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase WNK11 from Arabidopsis with 80.65% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase WNK11 from Arabidopsis with 81.65% of identity |
Eggnog | WNK lysine deficient protein kinase(ENOG410XQWZ) |
Kegg | Link to kegg annotations (AT5G55560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435659.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer