Protein coding transcript 173168

• Transcript: Ll_transcript_23146
• CDS coordinates: 1-318 (-)
• Peptide sequence: DHLFHIIWPPSSINYHFWPKNPPSYREANEEYLKYLHGVVDKLFKSMSIGLGLEEDELKKAAGGDDMIHLLKINYYPPCPFPDLVLGVPPHTDMSHITILVPNEVQ
• ORF Type: internal

Annotations of Ll_transcript_23146

• Blastp: Flavonol synthase/flavanone 3-hydroxylase from Petroselinum with 75.47% of identity
• Blastx: Flavonol synthase/flavanone 3-hydroxylase from Petroselinum with 75.47% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAP57395)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460312.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;