Protein coding transcript 173220

• Transcript: Ll_transcript_23056
• CDS coordinates: 219-1253 (+)
• Peptide sequence: MGVDYYKLLQVDKNVKDEELKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLGDPQKRAIYDQCGEEGLKGQVPPPDAGGGGSTYFSTGDIPGSFQFNPGNADDIFAEFFGFSSPFGGRGGGSDGMRSRFSGGMFGDDMFGPFGEGGGIHMSQGAPQKAPSVENKLTCTLEEIYRGTTKKMKIHREIADATGKTMHVEEILTINVKPGWKKGTKITFPEKGHEQPNVMPADLVFIIDEKPHNVFTRDGNDLIVNQKISLVDALTGYTVHLTTLDGRNLTISINNVIHSNYEEVVQREGMPLPKDPSKKGNLRIKFSIKFPTWLTDEQKEGIKKLWAASA*
• ORF Type: complete

Annotations of Ll_transcript_23056

• Blastp: DnaJ homolog subfamily B member 4 from Pongo with 44.32% of identity
• Blastx: DnaJ homolog subfamily B member 13 from Mus with 41.89% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (100174554)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414166.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;