Protein coding transcript 173240

• Transcript: Ll_transcript_24501
• CDS coordinates: 161-1378 (+)
• Peptide sequence: MALHDLKVLATLVVIVISWPISIEASVSPILDVSYLNRSSFPLGFIFGAASSAYQYEGAATKGGRGPSIWDTFTHKYPQKIKDRSNGDVADDSYHRYKEDIGIMKNMNFDAYRFSISWSRVLPKGKLSGGVNKEGINYYNNLIDELMANGLQPYVTIFHWDVPQALEDEYGGFLSPRIVDDFKDYAELCFKEFGDRVGHWITLNEPRSVSKNGYATGRFAPGRCSQWLKLNCTGGDSGTEPYLTSHYQLLAHAAAANLYKTKYQASQKGLIGITLNSDWFIPVSKDKADRDAARRAVDFMFGWYMKPLTKGKYPKSMRSMVGNRLPKFSKKEVKQLKGSFDFLGLNYYSSFYAAYAPHLGGARPTLQTDALVNVTSKQSLIVYYDILIISYLYACTSCFSSYVHA*
• ORF Type: complete

Annotations of Ll_transcript_24501

• Blastp: Cyanogenic beta-glucosidase from Trifolium with 72.46% of identity
• Blastx: Beta-glucosidase 12 from Oryza sativa with 59.88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000679)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448568.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;