Transcript | Ll_transcript_25199 |
---|---|
CDS coordinates | 2-334 (+) |
Peptide sequence | SSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEDGYEYEDEEEIGEDA* |
ORF Type | 5prime_partial |
Blastp | Tubulin beta-1 chain from Lupinus with 99.09% of identity |
---|---|
Blastx | Tubulin beta-1 chain from Daucus sect. Daucus with 100% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449650.1) |
Pfam | Tubulin C-terminal domain (PF03953.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer