| Transcript | Ll_transcript_25199 |
|---|---|
| CDS coordinates | 2-334 (+) |
| Peptide sequence | SSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEDGYEYEDEEEIGEDA* |
| ORF Type | 5prime_partial |
| Blastp | Tubulin beta-1 chain from Lupinus with 99.09% of identity |
|---|---|
| Blastx | Tubulin beta-1 chain from Daucus sect. Daucus with 100% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449650.1) |
| Pfam | Tubulin C-terminal domain (PF03953.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer