Transcript | Ll_transcript_318147 |
---|---|
CDS coordinates | 67-450 (+) |
Peptide sequence | MSQPSLAQFVMKRPWMMRWAQPLSNWYLNSAGYRQLGLRADDLIPEESELVQRALKRLSPKESYDRVFRMRRAFQCSLAHQLLPKTEWTKPEDDTPYISPIIAELEAEVTERQDLEAMVINKPTIKK* |
ORF Type | complete |
Blastp | Cytochrome b-c1 complex subunit 7 from Neurospora with 59.02% of identity |
---|---|
Blastx | Cytochrome b-c1 complex subunit 7 from Neurospora with 59.02% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU08940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437715.1) |
Pfam | Ubiquinol-cytochrome C reductase complex 14kD subunit (PF02271.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer