Protein coding transcript 17331

• Transcript: Ll_transcript_357026
• CDS coordinates: 738-1379 (+)
• Peptide sequence: MQVRNDNARKYLKEMRKKSPVPFEEKFPNADPLALRLLQRLLAFDPKDRPTAEEALADPYFYGLAKVEREPSCKPISKLEFEFERRRMTKEDVRGLLYREILEYHPKLLKDYMNGNEGANFLYNTSAIDQFRKQFVYVEENHGKSGPVLPPERKHVSLPRSTIHSSTIPPSTKSTLALHKNKQTVEEVSKNFRAAGSNFGNQFRGSMLPPRVPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_357026

• Blastp: Mitogen-activated protein kinase 8 from Oryza sativa with 71.76% of identity
• Blastx: Mitogen-activated protein kinase 19 from Arabidopsis with 65.73% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (4326853)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449238.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;