Protein coding transcript 173342

• Transcript: Ll_transcript_91298
• CDS coordinates: 142-777 (+)
• Peptide sequence: MASMRVLLLMLVVVVKRIEASGAFFVFGDSLVDSGNNNYLPTTARADSFPYGIDYPSHRPTGRFSNGFNLADLISQRIGSEAPSPYLSPELTGQKLLVGANFASAGIGILNDTGIQFVGILRIFKQLALFQQYQQRLSAEVGAEKAQQIVKRALVLMTLGGNDFVNNYFLTPFSLRSQQFTIPQFCNYLITEYKKFLLVIISHILIYIFSF*
• ORF Type: complete

Annotations of Ll_transcript_91298

• Blastp: GDSL esterase/lipase At4g28780 from Arabidopsis with 66.67% of identity
• Blastx: GDSL esterase/lipase LTL1 from Arabidopsis with 69.49% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT4G28780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003536954.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;