Transcript | Ll_transcript_357020 |
---|---|
CDS coordinates | 425-1270 (+) |
Peptide sequence | MFGMCYFSFYILILMALCLQYTPAIDLWSIGCIFAEVLRGKPLFPGKSVVHQLDLITDLLGTPSPETIAGVRNDNARKYLKEMRKKSPVPFEEKFPNADPLALRLLQRLLAFDPKDRPTAEEALADPYFYGLAKVEREPSCKPISKLEFEFERRRMTKEDVRGLLYREILEYHPKLLKDYMNGNEGANFLYNTSAIDQFRKQFVYVEENHGKSGPVLPPERKHVSLPRSTIHSSTIPPSTKSTLALHKNKQTVEEVSKNFRAAGSNFGNQFRGSMLPPRVPA |
ORF Type | 3prime_partial |
Blastp | Mitogen-activated protein kinase 19 from Arabidopsis with 69.78% of identity |
---|---|
Blastx | Mitogen-activated protein kinase 19 from Arabidopsis with 69.78% of identity |
Eggnog | Mitogen-activated protein kinase(ENOG410XNY0) |
Kegg | Link to kegg annotations (AT3G14720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449238.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer