Transcript | Ll_transcript_318094 |
---|---|
CDS coordinates | 2-412 (+) |
Peptide sequence | EVAKHLTESYGDRAWMVAALCAPTERGFPVRGERISPLYPYVDGEIRYACRHEYAETAADAIGRRTRLSFLNAQASLEALPKIIDLMAEEHQWSEKRKAFEWTDAVQYLGTMGLQPHKLTLTRADVENGNVGGYDDE |
ORF Type | internal |
Blastp | Glycerol-3-phosphate dehydrogenase, mitochondrial from Rattus with 49.54% of identity |
---|---|
Blastx | Glycerol-3-phosphate dehydrogenase, mitochondrial from Rattus with 49.54% of identity |
Eggnog | glycerol-3-phosphate dehydrogenase(COG0578) |
Kegg | Link to kegg annotations (25062) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016176560.1) |
Pfam | C-terminal domain of alpha-glycerophosphate oxidase (PF16901.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer