Protein coding transcript 1734

• Transcript: Ll_transcript_318094
• CDS coordinates: 2-412 (+)
• Peptide sequence: EVAKHLTESYGDRAWMVAALCAPTERGFPVRGERISPLYPYVDGEIRYACRHEYAETAADAIGRRTRLSFLNAQASLEALPKIIDLMAEEHQWSEKRKAFEWTDAVQYLGTMGLQPHKLTLTRADVENGNVGGYDDE
• ORF Type: internal

Annotations of Ll_transcript_318094

• Blastp: Glycerol-3-phosphate dehydrogenase, mitochondrial from Rattus with 49.54% of identity
• Blastx: Glycerol-3-phosphate dehydrogenase, mitochondrial from Rattus with 49.54% of identity
• Eggnog: glycerol-3-phosphate dehydrogenase(COG0578)
• Kegg: Link to kegg annotations (25062)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016176560.1)
• Pfam: C-terminal domain of alpha-glycerophosphate oxidase (PF16901.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;