Protein coding transcript 173464

• Transcript: Ll_transcript_90548
• CDS coordinates: 3-479 (+)
• Peptide sequence: ENHQSLDSLPQFQFNSPSSTTPFLKMAKAPAEKKPAAEKSPAEKKPRAEKKVPKEGSGEKKKRSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_90548

• Blastp: Probable histone H2B.1 from Medicago with 85.21% of identity
• Blastx: Probable histone H2B.1 from Medicago with 100% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_4g070240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458016.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;