Protein coding transcript 173498

• Transcript: Ll_transcript_89303
• CDS coordinates: 22-768 (+)
• Peptide sequence: MNLHCIPKISSVSFTPKASYPFINEATKPKSHPLPKRVNSVELSTQFLSTDSLGPTKQCFCGRRHFIEAAIIGTTLFPIQPSKATNSHSDYTALVNKFHPPRPDWYEEFYAWVMNSATKSYEAEVAMYKTQIFSDLKGKALKILEVGIGTGPNLSYYASNSDVQVVGIDPNPKMEKYARSSAKSAGLPLTNFEFIQAVGEAIPLSDASVDAVVGTLVLCSVRDVDMTLKGNETGTAFCFLFKHFFLVL*
• ORF Type: complete

Annotations of Ll_transcript_89303

• Blastp: Methyltransferase-like protein 7A from Homo with 36.15% of identity
• Blastx: Methyltransferase-like protein 7A from Homo with 36.15% of identity
• Eggnog: methyltransferase like 7A(ENOG4111EZC)
• Kegg: Link to kegg annotations (25840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429818.1)
• Pfam: ubiE/COQ5 methyltransferase family (PF01209.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;