Protein coding transcript 173547

• Transcript: Ll_transcript_91433
• CDS coordinates: 47-373 (+)
• Peptide sequence: MAPKKEKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQASYDKLLTEAPKFKLITPSILSDRLRINGSLARKAIRDLMARGSIRLVSAHSSQQIYTRATNT*
• ORF Type: complete

Annotations of Ll_transcript_91433

• Blastp: 40S ribosomal protein S25-4 from Arabidopsis with 90.74% of identity
• Blastx: 40S ribosomal protein S25-4 from Arabidopsis with 88.89% of identity
• Eggnog: Ribosomal protein S25(COG4901)
• Kegg: Link to kegg annotations (AT4G39200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464913.1)
• Pfam: S25 ribosomal protein (PF03297.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;