Transcript | Ll_transcript_91436 |
---|---|
CDS coordinates | 171-497 (+) |
Peptide sequence | MAPKKEKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNQVLFDQATYDKLLSEAPKYKLITPSILSDRLRINGSLARKAIRDLMARGSIRMVSAHSSQQIYTRATNT* |
ORF Type | complete |
Blastp | 40S ribosomal protein S25 from Lycopersicon with 92.59% of identity |
---|---|
Blastx | 40S ribosomal protein S25 from Lycopersicon with 91.67% of identity |
Eggnog | Ribosomal protein S25(COG4901) |
Kegg | Link to kegg annotations (544096) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438166.1) |
Pfam | S25 ribosomal protein (PF03297.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer