Transcript | Ll_transcript_91426 |
---|---|
CDS coordinates | 47-343 (+) |
Peptide sequence | MAPKKEKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQASYDKLLTEAPKFKLITPSILSDRLRVPILLLPFYVSCDMYISIIVEKDSVIF* |
ORF Type | complete |
Blastp | 40S ribosomal protein S25-4 from Arabidopsis with 93.06% of identity |
---|---|
Blastx | 40S ribosomal protein S25-4 from Arabidopsis with 91.67% of identity |
Eggnog | Ribosomal protein S25(COG4901) |
Kegg | Link to kegg annotations (AT4G39200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448487.1) |
Pfam | S25 ribosomal protein (PF03297.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer