Transcript | Ll_transcript_91101 |
---|---|
CDS coordinates | 1281-1655 (-) |
Peptide sequence | MKSEFLRGYLNKWKNTGNQIIPYAACEYFSQWVMWSSMHESCSIPNDLPKGHLVVYVGEKHTRFVIKIAILNHPLFKALLDQAQEEYDFIAADSKLCIPCDEHLFLSVLCRATSAQNERVFLCH* |
ORF Type | complete |
Blastp | Auxin-responsive protein SAUR50 from Helianthus with 43.84% of identity |
---|---|
Blastx | Auxin-responsive protein SAUR50 from Helianthus with 46.38% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424653.1) |
Pfam | Auxin responsive protein (PF02519.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer