Protein coding transcript 173649

• Transcript: Ll_transcript_89778
• CDS coordinates: 517-1056 (+)
• Peptide sequence: MMQGYPFSLSTTSSIGGFSPEQNTNPNPKPNQPPLPKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPLKLRQRSNKEVRKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCDKCSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSR*
• ORF Type: complete

Annotations of Ll_transcript_89778

• Blastp: Protein indeterminate-domain 2 from Arabidopsis with 77.09% of identity
• Blastx: Protein indeterminate-domain 2 from Arabidopsis with 86.52% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT3G50700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432274.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;