Protein coding transcript 173653

• Transcript: Ll_transcript_89787
• CDS coordinates: 112-441 (+)
• Peptide sequence: MKYVLVTGGVVSGLGKGVTASSIGVLLKACGLRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQSVIEKERRGDYLGKT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_89787

• Blastp: CTP synthase 1 from Danio with 82.73% of identity
• Blastx: CTP synthase 1 from Danio with 84.62% of identity
• Eggnog: Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen (By similarity)(COG0504)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020965325.1)
• Pfam: CTP synthase N-terminus (PF06418.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;