Protein coding transcript 173802

• Transcript: Ll_transcript_91547
• CDS coordinates: 2-475 (+)
• Peptide sequence: FSLTLLLLHCCSTKSDVQVLVHFMGTSDIIRKSTIHALYNEIAEKGRLNRLILIVQSKMTVYARKDLDASPFKVEILNMNDLLVNITKHVLQPKYQFLTADEKQALLAKHSLEEKQLPHMQKTDAIARYYGLEKGQVLKITHNGELVDSLVSYRCVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_91547

• Blastp: DNA-directed RNA polymerase V subunit 5C from Arabidopsis with 48.67% of identity
• Blastx: DNA-directed RNA polymerase V subunit 5C from Arabidopsis with 48.67% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates(COG2012)
• Kegg: Link to kegg annotations (AT3G54490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427747.1)
• Pfam: RNA polymerase Rpb5, C-terminal domain (PF01191.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;