Protein coding transcript 173859

• Transcript: Ll_transcript_90173
• CDS coordinates: 81-509 (+)
• Peptide sequence: MTKISPEVEIKMPMEAVPPVSADVSFISSSFPKYKLAADNQILDEPMEDNQGPSLKDVIEEEASNLSDQHERISVRDLASKFDKNLTAAAKLSNEAKLRDVASLEGHVLLKKLRDALEFLKGRFAGRNKEDVEKAISMVSYI*
• ORF Type: complete

Annotations of Ll_transcript_90173

• Blastp: Stomatal closure-related actin-binding protein 2 from Arabidopsis with 63.83% of identity
• Blastx: Stomatal closure-related actin-binding protein 2 from Arabidopsis with 63.83% of identity
• Eggnog: NA(ENOG410XTBS)
• Kegg: Link to kegg annotations (AT2G40820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458689.1)
• Pfam: Actin-binding domain of plant-specific actin-binding protein (PF16711.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;