Protein coding transcript 173907

• Transcript: Ll_transcript_90103
• CDS coordinates: 925-1302 (+)
• Peptide sequence: MKRNPRKVKWTKAYRRVHGKDMTQDSTFEFERKRNRPERYDRNLAENVLKAIPKIDKIRVGREERHHKNRMKGKKQKLQMEAVKELEQGISLVKAPSVFQQDQSLTLPKIVVSVSQQQSENRMEE*
• ORF Type: complete

Annotations of Ll_transcript_90103

• Blastp: Probable ribosome biogenesis protein RLP24 from Arabidopsis with 58.82% of identity
• Blastx: Probable ribosome biogenesis protein RLP24 from Arabidopsis with 61.42% of identity
• Eggnog: Ribosomal protein(COG2075)
• Kegg: Link to kegg annotations (AT2G44860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451223.1)
• Pfam: Ribosomal protein L24e (PF01246.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;