Protein coding transcript 17394

• Transcript: Ll_transcript_356637
• CDS coordinates: 1412-1945 (+)
• Peptide sequence: MFGRAWPFLAPVQQGLLPLWPQLLAQIRHVDCVNDEVASSWLNNAQVRKAIHAEQETVAGPWEICTDRIEYYGNAGNSMIPYHKNLTKLGYRALIFSGDHDMCVPFTGSEAWTRSMGYKIVDEWRPWISNDQVAGYLQAYDHNLIFLTIKGAGHTVPEYKPREALDFYTRWLEGKPI*
• ORF Type: complete

Annotations of Ll_transcript_356637

• Blastp: Serine carboxypeptidase-like 20 from Arabidopsis with 66.67% of identity
• Blastx: Serine carboxypeptidase-like 20 from Arabidopsis with 59.46% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT4G12910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439878.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;