Protein coding transcript 173965

• Transcript: Ll_transcript_90664
• CDS coordinates: 396-968 (+)
• Peptide sequence: MSSGNGSDEKRERKSDIDNSEDENSRSRRIMKGKGIGSLKKKALNASSRFKHSLQNKTLKNTRVTSVSIQDVRDLHELQAVDSFRQSLIMDELLPQPYDHYHIMLRFLKARKFDIEKAKHMWADMLQWRKEFGADTLMEVNADRSGTSICLLLLQINMHRTEPDILLSDRLTCICSASTALDISFFASGF*
• ORF Type: complete

Annotations of Ll_transcript_90664

• Blastp: Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 69.4% of identity
• Blastx: Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 from Arabidopsis with 80.73% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT4G39170)
• CantataDB: Link to cantataDB annotations (CNT0000925)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414867.1)
• Pfam: CRAL/TRIO, N-terminal domain (PF03765.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;