Protein coding transcript 1740

• Transcript: Ll_transcript_318150
• CDS coordinates: 2-499 (+)
• Peptide sequence: YANGNGGREMQYYLWFDPTEDYHTYSIDWNSRRIIILVDNIPIRVMRNRQDIGVPFPTKQPMRIYTTLWNGDSWATRWGKVKLDLLNAPFIAGFKNFNANACIAKTGEDCKVFNGGQNKGLDSESKQKWKVVLSKWVVYDYCRDFRRYAHGLPYECRKDNVLPVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_318150

• Blastp: Xyloglucan endotransglucosylase/hydrolase protein 15 from Arabidopsis with 48.5% of identity
• Blastx: Xyloglucan endotransglucosylase/hydrolase protein 15 from Arabidopsis with 48.5% of identity
• Eggnog: hydrolase family 16(COG2273)
• Kegg: Link to kegg annotations (AT4G14130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437117.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;