Protein coding transcript 174046

• Transcript: Ll_transcript_90574
• CDS coordinates: 402-761 (+)
• Peptide sequence: MGMAAAESQQYHVLAVDDSIIDRKLIERLLKTSSYQVTTVDSGSKALEFLGLQENDETNPITPCVSPKIHQDMEVNLVITDYCMPGMTGYDLLKKIKVCFGFYFLLSYISFTFSESSSG*
• ORF Type: complete

Annotations of Ll_transcript_90574

• Blastp: Two-component response regulator ARR9 from Arabidopsis with 68.93% of identity
• Blastx: Two-component response regulator ARR9 from Arabidopsis with 68.27% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT3G57040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435336.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;