Protein coding transcript 174156

• Transcript: Ll_transcript_89422
• CDS coordinates: 2250-2717 (+)
• Peptide sequence: MCCLSCLLFVLFCRMEDLVPILMRYVQSRQKPKGHVLLVGHNARVFDVPFIIHEFRRCSTEIPLDWLFLDTMSLARDLRNSDGTKLSSKSLAALQELYRIKVDGEAHRAMVDVNTLTSILPRLTYDLNLTLSDLVFKKSFRGSDIVDSKNKKKSS*
• ORF Type: complete

Annotations of Ll_transcript_89422

• Blastp: Exonuclease DPD1, chloroplastic/mitochondrial from Arabidopsis with 50% of identity
• Blastx: Exonuclease DPD1, chloroplastic/mitochondrial from Arabidopsis with 50.38% of identity
• Eggnog: three prime repair exonuclease(ENOG4111YSP)
• Kegg: Link to kegg annotations (AT5G26940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419638.1)
• Pfam: Exonuclease (PF00929.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;